PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0117s0033.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 486aa    MW: 52633.2 Da    PI: 9.7887
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0117s0033.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.32.7e-32200257159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ++DgynWrKYGqK+vkgse+prsYY+Ct+ +Cpvkkkvers  +++++ei+Y+g+Hnhe
  Kalax.0117s0033.1.p 200 VEDGYNWRKYGQKQVKGSEYPRSYYKCTHFHCPVKKKVERSP-QGQIIEIIYKGQHNHE 257
                          58****************************************.9**************8 PP

2WRKY105.62.7e-33376434159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDg++WrKYGqK+vkg+ +prsYY+Ct++gC+v+k+ver++ dpk+v++tYeg+Hnh+
  Kalax.0117s0033.1.p 376 LDDGFRWRKYGQKVVKGNSHPRSYYKCTTPGCNVRKHVERASADPKAVITTYEGKHNHD 434
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.056195259IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.3E-28197258IPR003657WRKY domain
SuperFamilySSF1182902.88E-25198258IPR003657WRKY domain
SMARTSM007741.7E-34200258IPR003657WRKY domain
PfamPF031064.1E-25201257IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.8E-36362435IPR003657WRKY domain
SuperFamilySSF1182901.05E-28368435IPR003657WRKY domain
PROSITE profilePS5081135.485371436IPR003657WRKY domain
SMARTSM007747.8E-40376435IPR003657WRKY domain
PfamPF031066.2E-26377434IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MAKNQLSSAS TVSSTHHPPR PATIALPPRT AAENLFATGF AGFSPGPMTL ASSLFPADAA  60
DPRSFSQLLA GAMASPLPDK SDSKYKQNRP LNLEVSPSPI FMVPPGFSPS GLLNSPGIFS  120
PAQSPFGMSH QQALAQVTAQ AALAHSNMQL QVNQTPFATP PESYKPPSTT EPKIASIAPS  180
ELALSVPKSQ PPIAAPDKPV EDGYNWRKYG QKQVKGSEYP RSYYKCTHFH CPVKKKVERS  240
PQGQIIEIIY KGQHNHEQTP PKKPAKDGNA PIENVGAQAT PDVHQPELDR AEALKRPMET  300
ALEQIVNGKD QKFLQEASID SRPLTTDETR GKADNDNGPI LKKRNTGSPA AEPTLPQKTV  360
VEPKIVVQTR SEVDLLDDGF RWRKYGQKVV KGNSHPRSYY KCTTPGCNVR KHVERASADP  420
KAVITTYEGK HNHDTQEGRS NSRGPPHPKS QTAAAERHTV PNEIEPTKNG QTGVAAPQLQ  480
EKVNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A9e-39200434875Probable WRKY transcription factor 4
1wj2_A9e-39200434875Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661104.11e-159PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI901e-132WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLF6H5W31e-158F6H5W3_VITVI; Putative uncharacterized protein
STRINGVIT_14s0108g01280.t011e-158(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-124WRKY DNA-binding protein 4